SC4MOL antibody (N-Term)

Catalog No. ABIN630307

Product Details anti-SC4MOL Antibody

Target: SC4MOL (MSMO1) (Methylsterol Monooxygenase 1 (MSMO1))

Binding Specificity: N-Term

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SC4MOL antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SC4 MOL antibody was raised against the N terminal of SC4 OL

Purification: Purified

Immunogen: SC4 MOL antibody was raised using the N terminal of SC4 OL corresponding to a region with amino acids MATNESVSIFSSASLAVEYVDSLLPENPLQEPFKNAWNYMLNNYTKFQIA

Application Details

Application Notes: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SC4MOL Blocking Peptide, catalog no. 33R-5780, is also available for use as a blocking control in assays to test for specificity of this SC4MOL antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SC0 OL antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SC4MOL

Target: SC4MOL (MSMO1) (Methylsterol Monooxygenase 1 (MSMO1))

Alternative Name: SC4MOL (MSMO1 Products)

Synonyms: sc4mol antibody, wu:fb59g06 antibody, wu:fb66e06 antibody, zgc:56437 antibody, DESP4 antibody, ERG25 antibody, SC4MOL antibody, Sc4mol antibody, 1500001G16Rik antibody, C78600 antibody, Msmo1 antibody, methylsterol monooxygenase 1 antibody, methylsterol monoxygenase 1 antibody, msmo1 antibody, MSMO1 antibody, Msmo1 antibody

Background: Sterol-C4-mehtyl oxidase-like protein was isolated based on its similarity to the yeast ERG25 protein. It contains a set of putative metal binding motifs with similarity to that seen in a family of membrane desaturases-hydroxylases.

Molecular Weight: 35 kDa (MW of target protein)