Add to Basket
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

1-Acylglycerol-3-Phosphate O-Acyltransferase 2 (Lysophosphatidic Acid Acyltransferase, Beta) (AGPAT2) antibody

Antigen

1-Acylglycerol-3-Phosphate O-Acyltransferase 2 (Lysophosphatidic Acid Acyltransferase, Beta) (AGPAT2)

Synonyms BSCL, BSCL1, LPAAB, 1-AGPAT2, LPAAT-beta, AV000834, 2510002J07Rik, AGPAT2, MGC138073, zgc:153984
Clonality Polyclonal
Host
Alternatives

Rabbit

Application
Alternatives Western Blotting (WB)
Catalog no. ABIN630343
Quantity 100 ug  (1 mg/ml)
Price 410.33 $   Plus shipping costs $35.00
Shipping to
Availability Ships within 5 to 7 Business Days

Additional Information

Alternative name AGPAT2
Immunogen AGPAT2 antibody was raised using the C terminal of AGPAT2 corresponding to a region with amino acids LEAIPTSGLTAADVPALVDTCHRAMRTTFLHISKTPQENGATAGSGVQPA
Description AGPAT2 is a member of the 1-acylglycerol-3-phosphate O-acyltransferase family. The protein is located within the endoplasmic reticulum membrane and converts lysophosphatidic acid to phosphatidic acid, the second step in de novo phospholipid biosynthesis. Mutations in its gene have been associated with congenital generalized lipodystrophy (CGL), or Berardinelli-Seip syndrome, a disease characterized by a near absence of adipose tissue and severe insulin resistance.
Molecular Weight 27 kDa (MW of target protein)

Application Details

Concentration 1 mg/ml
Purification Total IgG Protein A purified
Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of AGPAT2 antibody in PBS
Storage Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.
Restrictions For Research Use only

Alternatives

Alternatives for antigen "1-Acylglycerol-3-Phosphate O-Acyltransferase 2 (Lysophosphatidic Acid Acyltransferase, Beta) (AGPAT2)", type "Antibodies"
Hosts Rabbit (5), Mouse (3)
Reactivities Human (7)
Applications Western Blotting (WB) (8), ELISA (Detection) (2), Enzyme Immunoassay (EIA) (2)