SLC25A24 antibody
-
- Target See all SLC25A24 Antibodies
- SLC25A24 (Solute Carrier Family 25 (Mitochondrial Carrier, Phosphate Carrier), Member 24 (SLC25A24))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SLC25A24 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Purified
- Immunogen
- SLC25 A24 antibody was raised using a synthetic peptide corresponding to a region with amino acids FLFNPVTDIEEIIRFWKHSTGIDIGDSLTIPDEFTEDEKKSGQWWRQLLA
- Top Product
- Discover our top product SLC25A24 Primary Antibody
-
-
- Application Notes
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SLC25A24 Blocking Peptide, catalog no. 33R-2960, is also available for use as a blocking control in assays to test for specificity of this SLC25A24 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 24 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC25A24 (Solute Carrier Family 25 (Mitochondrial Carrier, Phosphate Carrier), Member 24 (SLC25A24))
- Alternative Name
- SLC25A24 (SLC25A24 Products)
- Synonyms
- SLC25A24 antibody, 2610016M12Rik antibody, apc1 antibody, scamc-1 antibody, scamc1-A antibody, slc25a24 antibody, APC1 antibody, SCAMC-1 antibody, EFINAL antibody, SCAMC1 antibody, calcium-binding mitochondrial carrier protein SCaMC-1-like antibody, solute carrier family 25 (mitochondrial carrier, phosphate carrier), member 24 antibody, solute carrier family 25 member 24 antibody, solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 24 L homeolog antibody, solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 24 antibody, LOC534742 antibody, Slc25a24 antibody, slc25a24.L antibody, SLC25A24 antibody, slc25a24 antibody
- Background
- SLC25A24 is a calcium-dependent mitochondrial solute carrier. Mitochondrial solute carriers shuttle metabolites, nucleotides, and cofactors through the mitochondrial inner membrane. It may act as a ATP-Mg/Pi exchanger that mediates the transport of Mg-ATP in exchange for phosphate, catalyzing the net uptake or efflux of adenine nucleotides into or from the mitochondria.
- Molecular Weight
- 45 kDa (MW of target protein)
-