Glucuronidase beta antibody (C-Term)

Catalog No. ABIN630431

Product Details anti-Glucuronidase beta Antibody

Target: Glucuronidase beta (GUSB) (Glucuronidase, beta (GUSB))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Glucuronidase beta antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: GUSB antibody was raised against the C terminal of GUSB

Purification: Purified

Immunogen: GUSB antibody was raised using the C terminal of GUSB corresponding to a region with amino acids VLGNKKGIFTRQRQPKSAAFLLRERYWKIANETRYPHSVAKSQCLENSPF

Application Details

Application Notes: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GUSB Blocking Peptide, catalog no. 33R-9662, is also available for use as a blocking control in assays to test for specificity of this GUSB antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GUSB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Glucuronidase beta

Target: Glucuronidase beta (GUSB) (Glucuronidase, beta (GUSB))

Alternative Name: GUSB (GUSB Products)

Synonyms: GUSB antibody, beta-GUS antibody, gus antibody, BG antibody, MPS7 antibody, AI747421 antibody, Gur antibody, Gus antibody, Gus-r antibody, Gus-s antibody, Gus-t antibody, Gus-u antibody, Gut antibody, asd antibody, g antibody, Ac2-223 antibody, si:ch211-160e1.7 antibody, si:ct573103.7 antibody, glucuronidase beta antibody, beta-D-glucuronidase antibody, beta-glucuronidase antibody, beta glucuronidase antibody, glucuronidase, beta antibody, GUSB antibody, bglR antibody, SSO_RS14735 antibody, Glu antibody, Gusb antibody, gusb antibody

Background: GUSB plays an important role in the degradation of dermatan and keratan sulfates.

Molecular Weight: 72 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process