CA4 antibody (Middle Region)

Catalog No. ABIN630435

The Rabbit Polyclonal anti-CA4 antibody (ABIN630435) specifically detects CA4 in WB. The antibody is reactive with Human samples.

Quick Overview for CA4 antibody (Middle Region) (ABIN630435)

Target: CA4 (Carbonic Anhydrase IV (CA4))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CA4 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-CA4 Antibody

Binding Specificity: Middle Region

Specificity: Carbonic Anhydrase IV antibody was raised against the middle region of CA4

Purification: Purified

Immunogen: Carbonic Anhydrase IV antibody was raised using the middle region of CA4 corresponding to a region with amino acids DGEHFAMEMHIVHEKEKGTSRNVKEAQDPEDEIAVLAFLVEAGTQVNEGF

Application Details

Application Notes: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Carbonic Anhydrase IV Blocking Peptide, (ABIN937332), is also available for use as a blocking control in assays to test for specificity of this Carbonic Anhydrase IV antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CA4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CA4

Target: CA4 (Carbonic Anhydrase IV (CA4))

Alternative Name: Carbonic Anhydrase IV

Background: Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. CA IV is a glycosylphosphatidyl-inositol-anchored membrane isozyme expressed on the luminal surfaces of pulmonary (and certain other) capillaries and of proximal renal tubules. Its exact function is not known, however, it may have a role in inherited renal abnormalities of bicarbonate transport.

Molecular Weight: 34 kDa (MW of target protein)