SLC43A3 antibody (N-Term)

Catalog No. ABIN630461

Product Details anti-SLC43A3 Antibody

Target: SLC43A3 (Solute Carrier Family 43, Member 3 (SLC43A3))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC43A3 antibody is un-conjugated

Application: Immunohistochemistry (IHC), Western Blotting (WB)

Specificity: SLC43 A3 antibody was raised against the N terminal of SLC43 3

Purification: Purified

Immunogen: SLC43 A3 antibody was raised using the N terminal of SLC43 3 corresponding to a region with amino acids MAGQGLPLHVATLLTGLLECLGFAGVLFGWPSLVFVFKNEDYFKDLCGPD

Application Details

Application Notes: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC43A3 Blocking Peptide, catalog no. 33R-5667, is also available for use as a blocking control in assays to test for specificity of this SLC43A3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC40 3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC43A3

Target: SLC43A3 (Solute Carrier Family 43, Member 3 (SLC43A3))

Alternative Name: SLC43A3 (SLC43A3 Products)

Synonyms: EEG1 antibody, FOAP-13 antibody, PRO1659 antibody, SEEEG-1 antibody, Eeg1 antibody, SLC43A3 antibody, zgc:136890 antibody, solute carrier family 43 member 3 antibody, solute carrier family 43, member 3 antibody, solute carrier family 43, member 3b antibody, SLC43A3 antibody, Slc43a3 antibody, slc43a3b antibody

Background: SLC43A3 belongs to the SLC43A transporter family and is a putative transporter.

Molecular Weight: 54 kDa (MW of target protein)