POLR1D antibody

Catalog No. ABIN630612

Product Details anti-POLR1D Antibody

Target: POLR1D (Polymerase (RNA) I Polypeptide D, 16kDa (POLR1D))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This POLR1D antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: POLR1 D antibody was raised using a synthetic peptide corresponding to a region with amino acids TRGTLPAVEPFQRGLNELMNVCQHVLDKFEASIKDYKDQKASRNESTF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

POLR1D Blocking Peptide, catalog no. 33R-9258, is also available for use as a blocking control in assays to test for specificity of this POLR1D antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of POLR0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for POLR1D

Target: POLR1D (Polymerase (RNA) I Polypeptide D, 16kDa (POLR1D))

Alternative Name: POLR1D (POLR1D Products)

Synonyms: AC19 antibody, POLR1C antibody, RPA16 antibody, RPA9 antibody, RPAC2 antibody, RPC16 antibody, RPO1-3 antibody, TCS2 antibody, 1110003G10Rik antibody, Rpo1-3 antibody, im:7162148 antibody, zgc:136449 antibody, polr1d antibody, rpa16 antibody, rpa9 antibody, rpac2 antibody, rpo1-3 antibody, RNA polymerase I subunit D antibody, polymerase (RNA) I polypeptide D antibody, polymerase (RNA) I polypeptide D, 16kDa, gene 2 L homeolog antibody, POLR1D antibody, Polr1d antibody, polr1d antibody, polr1d.2.L antibody

Background: POLR1D belongs to the archaeal rpoL/eukaryotic RPB11/RPC19 RNA polymerase subunit family. DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. POLR1D is the common core component of RNA polymerases I and III which synthesize ribosomal RNA precursors and small RNAs, such as 5S rRNA and tRNAs.

Molecular Weight: 15 kDa (MW of target protein)