H2AFY antibody (N-Term)

Catalog No. ABIN630699

The Rabbit Polyclonal anti-H2AFY antibody (ABIN630699) specifically detects H2AFY in WB. The antibody is reactive with Human samples.

Quick Overview for H2AFY antibody (N-Term) (ABIN630699)

Target: H2AFY (H2A Histone Family, Member Y (H2AFY))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This H2AFY antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-H2AFY Antibody

Binding Specificity: N-Term

Specificity: H2 AFY antibody was raised against the N terminal of H2 FY

Purification: Affinity purified

Immunogen: H2 AFY antibody was raised using the N terminal of H2 FY corresponding to a region with amino acids MSSRGGKKKSTKTSRSAKAGVIFPVGRMLRYIKKGHPKYRIGVGAPVYMA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

H2AFY Blocking Peptide, (ABIN5613916), is also available for use as a blocking control in assays to test for specificity of this H2AFY antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of H0 FY antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for H2AFY

Target: H2AFY (H2A Histone Family, Member Y (H2AFY))

Alternative Name: H2AFY

Background: Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes.

Molecular Weight: 41 kDa (MW of target protein)