NUP155 antibody (Middle Region)
-
- Target See all NUP155 Antibodies
- NUP155 (Nucleoporin 155kDa (NUP155))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This NUP155 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- NUP155 antibody was raised against the middle region of NUP155
- Purification
- Affinity purified
- Immunogen
- NUP155 antibody was raised using the middle region of NUP155 corresponding to a region with amino acids ISLHLQDICPLLYSTDDAICSKANELLQRSRQVQNKTEKERMLRESLKEY
- Top Product
- Discover our top product NUP155 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
NUP155 Blocking Peptide, catalog no. 33R-4155, is also available for use as a blocking control in assays to test for specificity of this NUP155 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NUP155 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NUP155 (Nucleoporin 155kDa (NUP155))
- Alternative Name
- NUP155 (NUP155 Products)
- Synonyms
- F10B6.25 antibody, F10B6_25 antibody, nucleoporin 155 antibody, DDBDRAFT_0189286 antibody, DDBDRAFT_0235243 antibody, DDB_0189286 antibody, DDB_0235243 antibody, D930027M19Rik antibody, mKIAA0791 antibody, zgc:55435 antibody, N155 antibody, nucleoporin 155 antibody, nucleoporin 155kDa antibody, nuclear pore protein antibody, nucleoporin 155kDa L homeolog antibody, NUP155 antibody, nup155 antibody, Nup155 antibody, nup155.L antibody
- Background
- Nucleoporins are the main components of the nuclear pore complex (NPC) of eukaryotic cells. They are involved in the bidirectional trafficking of molecules, especially mRNAs and proteins, between the nucleus and the cytoplasm. NUP155 does not contain the typical FG repeat sequences found in most vertebrate nucleoporins.
- Molecular Weight
- 147 kDa (MW of target protein)
- Pathways
- Protein targeting to Nucleus
-