MATN2 antibody (Middle Region)
-
- Target See all MATN2 Antibodies
- MATN2 (Matrilin 2 (MATN2))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This MATN2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- Matrilin 2 antibody was raised against the middle region of MATN2
- Purification
- Affinity purified
- Immunogen
- Matrilin 2 antibody was raised using the middle region of MATN2 corresponding to a region with amino acids AVGVGKAIEEELQEIASEPTNKHLFYAEDFSTMDEISEKLKKGICEALED
- Top Product
- Discover our top product MATN2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Matrilin 2 Blocking Peptide, catalog no. 33R-1598, is also available for use as a blocking control in assays to test for specificity of this Matrilin 2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MATN2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MATN2 (Matrilin 2 (MATN2))
- Alternative Name
- Matrilin 2 (MATN2 Products)
- Synonyms
- matn2 antibody, MGC53027 antibody, MGC76198 antibody, MATN2 antibody, DKFZp469F2020 antibody, Crtm2 antibody, matrilin-2 antibody, matrilin 2 L homeolog antibody, matrilin 2 antibody, matn2.L antibody, matn2 antibody, MATN2 antibody, Matn2 antibody
- Background
- MATN2 is a member of the von Willebrand factor A domain containing protein family. This family of proteins is thought to be involved in the formation of filamentous networks in the extracellular matrices of various tissues. This protein contains five von Willebrand factor A domains. The specific function of this gene has not yet been determined.
- Molecular Weight
- 102 kDa (MW of target protein)
-