CSTB antibody

Catalog No. ABIN630835

Product Details anti-CSTB Antibody

Target: CSTB (Cystatin B (Stefin B) (CSTB))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CSTB antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: Cystatin B antibody was raised using a synthetic peptide corresponding to a region with amino acids MMCGAPSATQPATAETQHIADQVRSQLEEKENKKFPVFKAVSFKSQVVAG

Application Details

Application Notes: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Cystatin B Blocking Peptide, catalog no. 33R-6226, is also available for use as a blocking control in assays to test for specificity of this Cystatin B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CSTB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CSTB

Target: CSTB (Cystatin B (Stefin B) (CSTB))

Alternative Name: Cystatin B (CSTB Products)

Synonyms: CST6 antibody, EPM1 antibody, EPM1A antibody, PME antibody, STFB antibody, ULD antibody, CSTB antibody, Cyb antibody, Epm1 antibody, Stfb antibody, MGC189005 antibody, pme antibody, cst6 antibody, epm1 antibody, stfb antibody, AA960480 antibody, ARABIDOPSIS THALIANA PHYTOCYSTATIN 6 antibody, ATCYS6 antibody, ATCYSB antibody, cystatin B antibody, LOC100008600 antibody, LOC100136235 antibody, CPI1 antibody, cystatin B antibody, cystatin B (stefin B) antibody, cystatin 14a, tandem duplicate 2 antibody, cystatin-B antibody, CSTB antibody, Cstb antibody, cstb antibody, cst14a.2 antibody, CYSB antibody, cpi1 antibody, LOC101123265 antibody

Background: CSTB is a stefin that functions as an intracellular thiol protease inhibitor. The protein is able to form a dimer stabilized by noncovalent forces, inhibiting papain and cathepsins l, h and b. The protein is thought to play a role in protecting against the proteases leaking from lysosomes. Evidence indicates that mutations in CSTB gene are responsible for the primary defects in patients with progressive myoclonic epilepsy a stefin that functions as an intracellular thiol protease inhibitor.

Molecular Weight: 11 kDa (MW of target protein)

Pathways: Response to Water Deprivation