Add to Basket
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Cytokeratin 13 (KRT13) antibody

Antigen

Cytokeratin 13 (KRT13)

Synonyms K13, CK13, MGC3781, MGC161462, Krt1-13, Krt-1.13
Clonality Polyclonal
Host
Alternatives

Rabbit

Application
Alternatives Western Blotting (WB)
Catalog no. ABIN630838
Quantity 50 ug  (1 mg/ml)  (Variants)
Price 478.33 $   Plus shipping costs $35.00
Shipping to
Availability Ships within 5 to 7 Business Days

Additional Information

Alternative name Cytokeratin 13
Immunogen Cytokeratin 13 antibody was raised using the N terminal of KRT13 corresponding to a region with amino acids TMQNLNDRLASYLEKVRALEEANADLEVKIRDWHLKQSPASPERDYSPYY
Description KRT13 is a member of the keratin gene family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins.
Molecular Weight 46 kDa (MW of target protein)

Application Details

Concentration 1 mg/ml
Purification Affinity purified
Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KRT13 antibody in PBS
Storage Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.
Research Area Signaling, Cytoskeleton, Extracellular Matrix
Restrictions For Research Use only

Alternatives

Alternatives for antigen "Cytokeratin 13 (KRT13)", type "Antibodies"
Hosts Mouse (15), Rabbit (5), Goat (4), Guinea Pig (1)
Reactivities Human (20), Rat (Rattus) (8), Cow (Bovine) (5), Mouse (Murine) (4), Rabbit (1)
Applications Western Blotting (WB) (19), Immunohistochemistry (IHC) (10), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (10), Immunohistochemistry (Frozen Sections) (IHC (fro)) (9), Enzyme Immunoassay (EIA) (4), Immunofluorescence (IF) (3), ELISA (2), Flow Cytometry (FACS) (1)
Epitopes N-Term (2), C-Term Isoform A (1)