NCAPH2 antibody (N-Term)
-
- Target See all NCAPH2 Antibodies
- NCAPH2 (Non-SMC Condensin II Complex, Subunit H2 (NCAPH2))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This NCAPH2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- NCAPH2 antibody was raised against the N terminal of NCAPH2
- Purification
- Affinity purified
- Immunogen
- NCAPH2 antibody was raised using the N terminal of NCAPH2 corresponding to a region with amino acids SGVPQEAENEFLSLDDFPDSRTNVDLKNDQTPSEVLIIPLLPMALVAPDE
- Top Product
- Discover our top product NCAPH2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
NCAPH2 Blocking Peptide, catalog no. 33R-8502, is also available for use as a blocking control in assays to test for specificity of this NCAPH2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NCAPH2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NCAPH2 (Non-SMC Condensin II Complex, Subunit H2 (NCAPH2))
- Alternative Name
- NCAPH2 (NCAPH2 Products)
- Synonyms
- MGC81656 antibody, CAPH2 antibody, si:dkey-202b22.2 antibody, non-SMC condensin II complex subunit H2 antibody, non-SMC condensin II complex subunit H2 L homeolog antibody, non-SMC condensin II complex, subunit H2 antibody, NCAPH2 antibody, ncaph2.L antibody, ncaph2 antibody, Ncaph2 antibody
- Background
- Condensin complexes I and II play essential roles in mitotic chromosome assembly and segregation. Both condensins contain 2 invariant structural maintenance of chromosome (SMC) subunits, SMC2 and SMC4, but they contain different sets of non-SMC subunits. NCAPH2 is 1 of 3 non-SMC subunits that define condensin II.
- Molecular Weight
- 68 kDa (MW of target protein)
-