PIWIL4 antibody

Catalog No. ABIN630848

The Rabbit Polyclonal anti-PIWIL4 antibody is suitable to detect PIWIL4 in samples from Human. It has been validated for WB.

Quick Overview for PIWIL4 antibody (ABIN630848)

Target: PIWIL4 (Piwi-Like 4 (PIWIL4))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PIWIL4 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PIWIL4 Antibody

Purification: Affinity purified

Immunogen: PIWIL4 antibody was raised using a synthetic peptide corresponding to a region with amino acids LSNNEASSSNGFLGTSRISTNDKYGISSGDAGSTFMERGVKNKQDFMDLS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PIWIL4 Blocking Peptide, (ABIN5615389), is also available for use as a blocking control in assays to test for specificity of this PIWIL4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PIWIL4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PIWIL4

Target: PIWIL4 (Piwi-Like 4 (PIWIL4))

Alternative Name: PIWIL4

Background: PIWIL4 belongs to the Argonaute family of proteins, which function in development and maintenance of germline stem cells.

Molecular Weight: 96 kDa (MW of target protein)