NARF antibody (Middle Region)
-
- Target See all NARF Antibodies
- NARF (Nuclear Prelamin A Recognition Factor (NARF))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This NARF antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- NARF antibody was raised against the middle region of NARF
- Purification
- Affinity purified
- Immunogen
- NARF antibody was raised using the middle region of NARF corresponding to a region with amino acids FRNIQNMILKLKKGKFPFHFVEVLACAGGCLNGRGQAQTPDGHADKALLR
- Top Product
- Discover our top product NARF Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
NARF Blocking Peptide, catalog no. 33R-3054, is also available for use as a blocking control in assays to test for specificity of this NARF antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NARF antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NARF (Nuclear Prelamin A Recognition Factor (NARF))
- Alternative Name
- NARF (NARF Products)
- Synonyms
- NARF antibody, IOP2 antibody, 4430402O11Rik antibody, RGD1310894 antibody, wu:fa03c01 antibody, zgc:92186 antibody, nuclear prelamin A recognition factor antibody, nuclear prelamin A recognition factor L homeolog antibody, NARF antibody, NAEGRDRAFT_78871 antibody, VDBG_04882 antibody, Tsp_07547 antibody, Tsp_07549 antibody, Narf antibody, narf antibody, narf.L antibody
- Background
- NARF binds to the prenylated prelamin A carboxyl-terminal tail domain. It may be a component of a prelamin A endoprotease complex. NARF is located in the nucleus, where it partially colocalizes with the nuclear lamina. It shares limited sequence similarity with iron-only bacterial hydrogenases.
- Molecular Weight
- 55 kDa (MW of target protein)
-