DYNLL2 antibody (N-Term)
-
- Target See all DYNLL2 Antibodies
- DYNLL2 (Dynein, Light Chain, LC8-Type 2 (DYNLL2))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat, C. elegans, Drosophila melanogaster
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This DYNLL2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- DYNLL2 antibody was raised against the N terminal of DYNLL2
- Purification
- Affinity purified
- Immunogen
- DYNLL2 antibody was raised using the N terminal of DYNLL2 corresponding to a region with amino acids MSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKY
- Top Product
- Discover our top product DYNLL2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
DYNLL2 Blocking Peptide, catalog no. 33R-6410, is also available for use as a blocking control in assays to test for specificity of this DYNLL2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DYNLL2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DYNLL2 (Dynein, Light Chain, LC8-Type 2 (DYNLL2))
- Alternative Name
- DYNLL2 (DYNLL2 Products)
- Synonyms
- DNCL1B antibody, Dlc2 antibody, RSPH22 antibody, dlc2 antibody, dncl1b antibody, 1700064A15Rik antibody, 6720463E02Rik antibody, C87222 antibody, DLC8 antibody, DLC8b antibody, dynein light chain LC8-type 2 antibody, dynein light chain LC8-type 2 S homeolog antibody, DYNLL2 antibody, dynll2.S antibody, dynll2 antibody, Dynll2 antibody
- Background
- DYNLL2 belongs to the dynein light chain family. DYNLL2 may be involved in some aspects of dynein-related intracellular transport and motility. It may play a role in changing or maintaining the spatial distribution of cytoskeletal structures.
- Molecular Weight
- 10 kDa (MW of target protein)
- Pathways
- M Phase
-