HUS1B antibody

Catalog No. ABIN630912

Product Details anti-HUS1B Antibody

Target: HUS1B (HUS1 Checkpoint Homolog B (HUS1B))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HUS1B antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: HUS1 B antibody was raised using a synthetic peptide corresponding to a region with amino acids ELFIHVSGTVARLAKVCVLRVRPDSLCFGPAGSGGLHEARLWCEVRQGAF

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HUS1B Blocking Peptide, catalog no. 33R-2540, is also available for use as a blocking control in assays to test for specificity of this HUS1B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HUS0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for HUS1B

Target: HUS1B (HUS1 Checkpoint Homolog B (HUS1B))

Alternative Name: HUS1B (HUS1B Products)

Synonyms: HUS1B antibody, RP11-532F6.1 antibody, HUS1 checkpoint clamp component B antibody, HUS1B antibody, Hus1b antibody

Background: HUS1Bis most closely related to HUS1, a component of a cell cycle checkpoint protein complex involved in cell cycle arrest in response to DNA damage. HUS1B can interact with the check point protein RAD1 but not with RAD9. Overexpression of HUS1B has been shown to induce cell death, which suggests a related but distinct role of this protein, as compared to the HUS1.

Molecular Weight: 31 kDa (MW of target protein)