GCET2 antibody (Middle Region)
-
- Target See all GCET2 Antibodies
- GCET2 (Germinal Center Expressed Transcript 2 (GCET2))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This GCET2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- GCET2 antibody was raised against the middle region of GCET2
- Purification
- Affinity purified
- Immunogen
- GCET2 antibody was raised using the middle region of GCET2 corresponding to a region with amino acids YSLLHMPSTDPRHARSPEDEYELLMPHRISSHFLQQPRPLMAPSETQFSH
- Top Product
- Discover our top product GCET2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
GCET2 Blocking Peptide, catalog no. 33R-10243, is also available for use as a blocking control in assays to test for specificity of this GCET2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GCET2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GCET2 (Germinal Center Expressed Transcript 2 (GCET2))
- Alternative Name
- GCET2 (GCET2 Products)
- Synonyms
- Gcet antibody, Gcet2 antibody, M17 antibody, M17-L antibody, GCAT2 antibody, GCET2 antibody, HGAL antibody, germinal center associated, signaling and motility antibody, germinal center associated signaling and motility antibody, germinal center-associated, signaling and motility antibody, Gcsam antibody, GCSAM antibody
- Background
- GCET2 is a protein which may function in signal transduction pathways and whose expression is elevated in germinal cell lymphomas. It contains a putative PDZ-interacting domain, an immunoreceptor tyrosine-based activation motif (ITAM), and two putative SH2 binding sites. In B cells, its expression is specifically induced by interleukin-4.
- Molecular Weight
- 21 kDa (MW of target protein)
-