GCET2 antibody (Middle Region)

Catalog No. ABIN630927

Product Details anti-GCET2 Antibody

Target: GCET2 (Germinal Center Expressed Transcript 2 (GCET2))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GCET2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: GCET2 antibody was raised against the middle region of GCET2

Purification: Affinity purified

Immunogen: GCET2 antibody was raised using the middle region of GCET2 corresponding to a region with amino acids YSLLHMPSTDPRHARSPEDEYELLMPHRISSHFLQQPRPLMAPSETQFSH

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GCET2 Blocking Peptide, catalog no. 33R-10243, is also available for use as a blocking control in assays to test for specificity of this GCET2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GCET2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GCET2

Target: GCET2 (Germinal Center Expressed Transcript 2 (GCET2))

Alternative Name: GCET2 (GCET2 Products)

Synonyms: Gcet antibody, Gcet2 antibody, M17 antibody, M17-L antibody, GCAT2 antibody, GCET2 antibody, HGAL antibody, germinal center associated, signaling and motility antibody, germinal center associated signaling and motility antibody, germinal center-associated, signaling and motility antibody, Gcsam antibody, GCSAM antibody

Background: GCET2 is a protein which may function in signal transduction pathways and whose expression is elevated in germinal cell lymphomas. It contains a putative PDZ-interacting domain, an immunoreceptor tyrosine-based activation motif (ITAM), and two putative SH2 binding sites. In B cells, its expression is specifically induced by interleukin-4.

Molecular Weight: 21 kDa (MW of target protein)