NDUFV3 antibody
-
- Target See all NDUFV3 Antibodies
- NDUFV3 (NADH Dehydrogenase (Ubiquinone) Flavoprotein 3, 10kDa (NDUFV3))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This NDUFV3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- NDUFV3 antibody was raised using a synthetic peptide corresponding to a region with amino acids PAPVPAEPFDNTTYKNLQHHDYSTYTFLDLNLELSKFRMPQPSSGRESPR
- Top Product
- Discover our top product NDUFV3 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
NDUFV3 Blocking Peptide, catalog no. 33R-6975, is also available for use as a blocking control in assays to test for specificity of this NDUFV3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NDUFV3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NDUFV3 (NADH Dehydrogenase (Ubiquinone) Flavoprotein 3, 10kDa (NDUFV3))
- Alternative Name
- NDUFV3 (NDUFV3 Products)
- Synonyms
- CI-10k antibody, CI-9KD antibody, Mipp65 antibody, Ndufv3l antibody, 1500032D16Rik antibody, wu:fl83h06 antibody, NADH:ubiquinone oxidoreductase subunit V3 antibody, NADH dehydrogenase (ubiquinone) flavoprotein 3 antibody, NDUFV3 antibody, Ndufv3 antibody, ndufv3 antibody
- Background
- The protein encoded by this gene is one of at least forty-one subunits that make up the NADH-ubiquinone oxidoreductase complex. This complex is part of the mitochondrial respiratory chain and serves to catalyze the rotenone-sensitive oxidation of NADH and
- Molecular Weight
- 47 kDa (MW of target protein)
-