INPP5B antibody (Middle Region)

Catalog No. ABIN631045

This Rabbit Polyclonal antibody specifically detects INPP5B in WB. It exhibits reactivity toward Human and Mouse.

Quick Overview for INPP5B antibody (Middle Region) (ABIN631045)

Target: INPP5B (Inositol Polyphosphate-5-Phosphatase, 75kDa (INPP5B))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This INPP5B antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-INPP5B Antibody

Binding Specificity: Middle Region

Specificity: INPP5 B antibody was raised against the middle region of INPP5

Purification: Affinity purified

Immunogen: INPP5 B antibody was raised using the middle region of INPP5 corresponding to a region with amino acids IHNGQVPCHFEFINKPDEESYCKQWLNANPSRGFLLPDSDVEIDLELFVN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

INPP5B Blocking Peptide, (ABIN939370), is also available for use as a blocking control in assays to test for specificity of this INPP5B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of INPP0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for INPP5B

Target: INPP5B (Inositol Polyphosphate-5-Phosphatase, 75kDa (INPP5B))

Alternative Name: INPP5B

Background: Cellular calcium signaling is controlled by the production of inositol phosphates (IPs) by phospholipase C in response to extracellular signals. The IP signaling molecules are inactivated by a family of inositol polyphosphate-5-phosphatases (5-phosphatases). INPP5B is the type II 5-phosphatase. The protein is localized to the cytosol and mitochondria, and associates with membranes through an isoprenyl modification near the C-terminus.

Molecular Weight: 77 kDa (MW of target protein)