VPS28 antibody

Catalog No. ABIN631062

The Rabbit Polyclonal anti-VPS28 antibody (ABIN631062) specifically detects VPS28 in WB. The antibody is reactive with Human, Mouse and Rat samples.

Quick Overview for VPS28 antibody (ABIN631062)

Target: VPS28 (Vacuolar Protein Sorting 28 (VPS28))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This VPS28 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-VPS28 Antibody

Purification: Affinity purified

Immunogen: VPS28 antibody was raised using a synthetic peptide corresponding to a region with amino acids MFHGIPATPGIGAPGNKPELYEEVKLYKNAREREKYDNMAELFAVVKTMQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

VPS28 Blocking Peptide, (ABIN5616976), is also available for use as a blocking control in assays to test for specificity of this VPS28 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VPS28 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for VPS28

Target: VPS28 (Vacuolar Protein Sorting 28 (VPS28))

Alternative Name: VPS28

Background: This gene encodes a protein involved in endosomal sorting of cell surface receptors via a multivesicular body/late endosome pathway.

Molecular Weight: 25 kDa (MW of target protein)