Acetyl-CoA Acyltransferase 2 (ACAA2) antibody

Antigen: Acetyl-CoA Acyltransferase 2 (ACAA2)

Synonyms: ACAT2, ARGP2, ACACT2, MGC116732, DSAEC, FLJ35992, FLJ95265, fb10a06, fb53f08, wu:fb10a06, wu:fb53f08, Tcp-1x, AW742799, Tcp1-rs1, MGC36039, D15Wsu97e, Acat-2, Ab2-076, MGC95138, acat2, MGC76038, fb59b11, zgc:56036, wu:fb59b11, MGC140551, ACAA2, MGC127380, MGC89951, ACETOACETYL-COA THIOLASE 2, EMB1276, EMBRYO DEFECTIVE 1276, MIF21.12, MIF21_12, DKFZp469F1024, DKFZp470L0527

Clonality: Polyclonal

Host: Rabbit

Application: Western Blotting (WB)

Catalog no.: ABIN631066

Additional Information

Alternative name: ACAA2

Immunogen: ACAA2 antibody was raised using the N terminal of ACAA2 corresponding to a region with amino acids ALLRGVFVVAAKRTPFGAYGGLLKDFTATDLSEFAAKAALSAGKVSPETV

Description: ACAA2 catalyzes the last step of the mitochondrial fatty acid beta-oxidation spiral. Unlike most mitochondrial matrix proteins, it contains a non-cleavable amino-terminal targeting signal.

Molecular Weight: 42 kDa (MW of target protein)

Synonyms: ACAT2, ARGP2, ACACT2, MGC116732, DSAEC, FLJ35992, FLJ95265, fb10a06, fb53f08, wu:fb10a06, wu:fb53f08, Tcp-1x, AW742799, Tcp1-rs1, MGC36039, D15Wsu97e, Acat-2, Ab2-076, MGC95138, acat2, MGC76038, fb59b11, zgc:56036, wu:fb59b11, MGC140551, ACAA2, MGC127380, MGC89951, ACETOACETYL-COA THIOLASE 2, EMB1276, EMBRYO DEFECTIVE 1276, MIF21.12, MIF21_12, DKFZp469F1024, DKFZp470L0527

Application Details

Concentration: 1 mg/ml

Purification: Affinity purified

Buffer: Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ACAA2 antibody in PBS

Storage: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.

Research Area: Cardiovascular, Fatty Acids, Metabolism, Organelles

Restrictions: For Research Use only