ME3 antibody

Catalog No. ABIN631075

This Rabbit Polyclonal antibody specifically detects ME3 in WB. It exhibits reactivity toward Human and Mouse.

Quick Overview for ME3 antibody (ABIN631075)

Target: ME3 (Malic Enzyme 3, NADP(+)-Dependent, Mitochondrial (ME3))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ME3 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ME3 Antibody

Purification: Affinity purified

Immunogen: ME3 antibody was raised using a synthetic peptide corresponding to a region with amino acids PGPARPVPLKKRGYDVTRNPHLNKGMAFTLEERLQLGIHGLIPPCFLSQD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ME3 Blocking Peptide, (ABIN5614717), is also available for use as a blocking control in assays to test for specificity of this ME3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ME3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ME3

Target: ME3 (Malic Enzyme 3, NADP(+)-Dependent, Mitochondrial (ME3))

Alternative Name: ME3

Background: Malic enzyme catalyzes the oxidative decarboxylation of malate to pyruvate using either NAD+ or NADP+ as a cofactor. Mammalian tissues contain 3 distinct isoforms of malic enzyme: a cytosolic NADP(+)-dependent isoform, a mitochondrial NADP(+)-dependent isoform, and a mitochondrial NAD(+)-dependent isoform. ME3 is a mitochondrial NADP(+)-dependent isoform.

Molecular Weight: 67 kDa (MW of target protein)

Pathways: Warburg Effect