HAX1 antibody (Middle Region)

Catalog No. ABIN631119

The Rabbit Polyclonal anti-HAX1 antibody (ABIN631119) specifically detects HAX1 in WB. The antibody is reactive with Human and Mouse samples.

Quick Overview for HAX1 antibody (Middle Region) (ABIN631119)

Target: HAX1 (HCLS1 Associated Protein X-1 (HAX1))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HAX1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-HAX1 Antibody

Binding Specificity: Middle Region

Specificity: HAX1 antibody was raised against the middle region of HAX1

Purification: Affinity purified

Immunogen: HAX1 antibody was raised using the middle region of HAX1 corresponding to a region with amino acids LPGPESETPGERLREGQTLRDSMLKYPDSHQPRIFGGVLESDARSESPQP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HAX1 Blocking Peptide, (ABIN5613936), is also available for use as a blocking control in assays to test for specificity of this HAX1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HAX1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for HAX1

Target: HAX1 (HCLS1 Associated Protein X-1 (HAX1))

Alternative Name: HAX1

Background: HAX1 is known to associate with hematopoietic cell-specific Lyn substrate 1, a substrate of Src family tyrosine kinases. It also interacts with the product of the polycystic kidney disease 2 gene, mutations in which are associated with autosomal-dominant polycystic kidney disease, and with the F-actin-binding protein, cortactin. It was earlier thought that this gene product is mainly localized in the mitochondria, however, recent studies indicate it to be localized in the cell body. Mutations in this gene result in autosomal recessive severe congenital neutropenia, also known as Kostmann disease.

Molecular Weight: 31 kDa (MW of target protein)

Pathways: Regulation of Actin Filament Polymerization