SHC3 antibody

Catalog No. ABIN631135

This Rabbit Polyclonal antibody specifically detects SHC3 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for SHC3 antibody (ABIN631135)

Target: SHC3 (SHC (Src Homology 2 Domain Containing) Transforming Protein 3 (SHC3))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SHC3 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SHC3 Antibody

Purification: Affinity purified

Immunogen: SHC3 antibody was raised using a synthetic peptide corresponding to a region with amino acids RLKPRPHAPDTAQFAGKEQTYYQGRHLGDTFGEDWQQTPLRQGSSDIYST

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SHC3 Blocking Peptide, (ABIN5616130), is also available for use as a blocking control in assays to test for specificity of this SHC3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SHC3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SHC3

Target: SHC3 (SHC (Src Homology 2 Domain Containing) Transforming Protein 3 (SHC3))

Alternative Name: SHC3

Background: SHC3 is a signaling adapter that couples activated growth factor receptors to signaling pathway in neurons. SHC3 is involved in the signal transduction pathways of neurotrophin-activated Trk receptors in cortical neurons.

Molecular Weight: 64 kDa (MW of target protein)

Pathways: RTK Signaling, EGFR Signaling Pathway, Neurotrophin Signaling Pathway