DYNLL1 antibody (N-Term)

Catalog No. ABIN631146

Product Details anti-DYNLL1 Antibody

Target: DYNLL1 (Dynein, Light Chain, LC8-Type 1 (DYNLL1))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat, Drosophila melanogaster

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DYNLL1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: DYNLL1 antibody was raised against the N terminal of DYNLL1

Purification: Affinity purified

Immunogen: DYNLL1 antibody was raised using the N terminal of DYNLL1 corresponding to a region with amino acids MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKY

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DYNLL1 Blocking Peptide, catalog no. 33R-5809, is also available for use as a blocking control in assays to test for specificity of this DYNLL1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DYNLL1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DYNLL1

Target: DYNLL1 (Dynein, Light Chain, LC8-Type 1 (DYNLL1))

Alternative Name: DYNLL1 (DYNLL1 Products)

Synonyms: DLC1 antibody, DLC8 antibody, DNCL1 antibody, DNCLC1 antibody, LC8 antibody, LC8a antibody, PIN antibody, hdlc1 antibody, dynll2 antibody, wu:fd56c09 antibody, zgc:73406 antibody, Dlc8 antibody, Dnclc1 antibody, Pin antibody, 8kDLC antibody, lc8 antibody, dlc1 antibody, dlc8 antibody, lc8a antibody, dncl1 antibody, dnclc1 antibody, dynll1a antibody, MGC68763 antibody, CDLC2 antibody, dynll1 antibody, dynll1b antibody, pin antibody, MGC89636 antibody, dynein light chain LC8-type 1 antibody, dynein, light chain, LC8-type 1 antibody, dynein light chain LC8-type 1 S homeolog antibody, dynein light chain LC8-type 1 L homeolog antibody, Dynein light chain 1, cytoplasmic antibody, DYNLL1 antibody, dynll1 antibody, Dynll1 antibody, dynll1.S antibody, dynll1.L antibody, dlc-1 antibody

Background: Cytoplasmic dyneins are large enzyme complexes with a molecular mass of about 1,200 kDa. They contain two force-producing heads formed primarily from dynein heavy chains, and stalks linking the heads to a basal domain, which contains a varying number of accessory intermediate chains. The complex is involved in intracellular transport and motility. DYNLL1 is a light chain and exists as part of this complex but also physically interacts with and inhibits the activity of neuronal nitric oxide synthase. Binding of this protein destabilizes the neuronal nitric oxide synthase dimer, a conformation necessary for activity, and it may regulate numerous biologic processes through its effects on nitric oxide synthase activity.

Molecular Weight: 10 kDa (MW of target protein)

Pathways: M Phase, Tube Formation, Positive Regulation of Endopeptidase Activity