FABP3 antibody

Catalog No. ABIN631167

Product Details anti-FABP3 Antibody

Target: FABP3 (Fatty Acid Binding Protein 3, Muscle and Heart (FABP3))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FABP3 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: FABP3 antibody was raised using a synthetic peptide corresponding to a region with amino acids MTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FABP3 Blocking Peptide, catalog no. 33R-6549, is also available for use as a blocking control in assays to test for specificity of this FABP3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FABP3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FABP3

Target: FABP3 (Fatty Acid Binding Protein 3, Muscle and Heart (FABP3))

Alternative Name: FABP3 (FABP3 Products)

Synonyms: Fabph-1 antibody, Fabph-4 antibody, Fabph1 antibody, Fabph4 antibody, H-FABP antibody, Mdgi antibody, FABP11 antibody, M-FABP antibody, MDGI antibody, O-FABP antibody, FABP antibody, FABP-3 antibody, fabp3 antibody, fatty acid binding protein 3 antibody, fatty acid binding protein 3, muscle and heart antibody, FABP3 antibody, Fabp3 antibody, fabp3 antibody

Background: The intracellular fatty acid-binding proteins (FABPs) belongs to a multigene family. FABPs are divided into at least three distinct types, namely the hepatic-, intestinal- and cardiac-type. They form 14-15 kDa proteins and are thought to participate in the uptake, intracellular metabolism and/or transport of long-chain fatty acids. They may also be responsible in the modulation of cell growth and proliferation. Fatty acid-binding protein 3 gene contains four exons and its function is to arrest growth of mammary epithelial cells. FABP3 gene is a candidate tumor suppressor gene for human breast cancer.

Molecular Weight: 15 kDa (MW of target protein)

Pathways: Monocarboxylic Acid Catabolic Process