FABP3 antibody
-
- Target See all FABP3 Antibodies
- FABP3 (Fatty Acid Binding Protein 3, Muscle and Heart (FABP3))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This FABP3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- FABP3 antibody was raised using a synthetic peptide corresponding to a region with amino acids MTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIV
- Top Product
- Discover our top product FABP3 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
FABP3 Blocking Peptide, catalog no. 33R-6549, is also available for use as a blocking control in assays to test for specificity of this FABP3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FABP3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FABP3 (Fatty Acid Binding Protein 3, Muscle and Heart (FABP3))
- Alternative Name
- FABP3 (FABP3 Products)
- Synonyms
- Fabph-1 antibody, Fabph-4 antibody, Fabph1 antibody, Fabph4 antibody, H-FABP antibody, Mdgi antibody, FABP11 antibody, M-FABP antibody, MDGI antibody, O-FABP antibody, FABP antibody, FABP-3 antibody, fabp3 antibody, fatty acid binding protein 3 antibody, fatty acid binding protein 3, muscle and heart antibody, FABP3 antibody, Fabp3 antibody, fabp3 antibody
- Background
- The intracellular fatty acid-binding proteins (FABPs) belongs to a multigene family. FABPs are divided into at least three distinct types, namely the hepatic-, intestinal- and cardiac-type. They form 14-15 kDa proteins and are thought to participate in the uptake, intracellular metabolism and/or transport of long-chain fatty acids. They may also be responsible in the modulation of cell growth and proliferation. Fatty acid-binding protein 3 gene contains four exons and its function is to arrest growth of mammary epithelial cells. FABP3 gene is a candidate tumor suppressor gene for human breast cancer.
- Molecular Weight
- 15 kDa (MW of target protein)
- Pathways
- Monocarboxylic Acid Catabolic Process
-