IMPA2 antibody (Middle Region)

Catalog No. ABIN631172

The Rabbit Polyclonal anti-IMPA2 antibody is suitable to detect IMPA2 in samples from Human. It has been validated for WB.

Quick Overview for IMPA2 antibody (Middle Region) (ABIN631172)

Target: IMPA2 (Inositol(myo)-1(or 4)-Monophosphatase 2 (IMPA2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This IMPA2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-IMPA2 Antibody

Binding Specificity: Middle Region

Specificity: IMPA2 antibody was raised against the middle region of IMPA2

Purification: Affinity purified

Immunogen: IMPA2 antibody was raised using the middle region of IMPA2 corresponding to a region with amino acids RGRGAFCNGQRLRVSGETDLSKALVLTEIGPKRDPATLKLFLSNMERLLH

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

IMPA2 Blocking Peptide, (ABIN5614186), is also available for use as a blocking control in assays to test for specificity of this IMPA2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IMPA2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for IMPA2

Target: IMPA2 (Inositol(myo)-1(or 4)-Monophosphatase 2 (IMPA2))

Alternative Name: IMPA2

Background: IMPA2 belongs to the inositol monophosphatase family. The present study suggests that a promoter haplotype of IMPA2 possibly contributes to risk for bipolar disorder by elevating IMPA2 levels in the brain, albeit the genetic effect varies among populations.

Molecular Weight: 32 kDa (MW of target protein)