ISYNA1 antibody (N-Term)

Catalog No. ABIN631226

Product Details anti-ISYNA1 Antibody

Target: ISYNA1 (Inositol-3-Phosphate Synthase 1 (ISYNA1))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ISYNA1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ISYNA1 antibody was raised against the N terminal of ISYNA1

Purification: Affinity purified

Immunogen: ISYNA1 antibody was raised using the N terminal of ISYNA1 corresponding to a region with amino acids LQEQLWPHMEALRPRPSVYIPEFIAANQSARADNLIPGSRAQQLEQIRRD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ISYNA1 Blocking Peptide, catalog no. 33R-5306, is also available for use as a blocking control in assays to test for specificity of this ISYNA1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ISYNA1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ISYNA1

Target: ISYNA1 (Inositol-3-Phosphate Synthase 1 (ISYNA1))

Alternative Name: ISYNA1 (ISYNA1 Products)

Synonyms: INO1 antibody, INOS antibody, IPS antibody, IPS 1 antibody, IPS-1 antibody, 1300017C10Rik antibody, AU018670 antibody, IPS 1-A antibody, MI-1-P synthase A antibody, MIP synthase A antibody, ino1 antibody, ino1-a antibody, inos antibody, ips antibody, isyna1 antibody, isyna1-a antibody, isyna1-b antibody, IPS 1-B antibody, MI-1-P synthase B antibody, MIP synthase B antibody, ino1-B antibody, inositol-3-phosphate synthase 1 antibody, myo-inositol 1-phosphate synthase A1 antibody, inositol-3-phosphate synthase 1 S homeolog antibody, inositol-3-phosphate synthase 1 L homeolog antibody, ISYNA1 antibody, Isyna1 antibody, sce1804 antibody, isyna1.S antibody, isyna1.L antibody

Background: Myoinositol, the most common naturally occurring form of inositol, is a component of plasma membrane phospholipids and functions as a cell signaling molecule. ISYNA1 (EC 5.5.1.4), or IPS, is a rate-limiting enzyme that catalyzes the de novo synthesis of myoinositol 1-phosphate from glucose 6-phosphate.

Molecular Weight: 61 kDa (MW of target protein)