UBE2K antibody

Catalog No. ABIN631297

This Rabbit Polyclonal antibody specifically detects UBE2K in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for UBE2K antibody (ABIN631297)

Target: UBE2K (Ubiquitin-Conjugating Enzyme E2K (UBE2K))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This UBE2K antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-UBE2K Antibody

Purification: Affinity purified

Immunogen: UBE2 K antibody was raised using a synthetic peptide corresponding to a region with amino acids QTARLWAHVYAGAPVSSPEYTKKIENLCAMGFDRNAVIVALSSKSWDVET

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

UBE2K Blocking Peptide, (ABIN5616870), is also available for use as a blocking control in assays to test for specificity of this UBE2K antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBE0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for UBE2K

Target: UBE2K (Ubiquitin-Conjugating Enzyme E2K (UBE2K))

Alternative Name: UBE2K

Background: UBE2K belongs to the ubiquitin-conjugating enzyme family. This protein interacts with RING finger proteins, and it can ubiquitinate huntingtin, the gene product for Huntington's disease. Known functions for this protein include a role in aggregate formation of expanded polyglutamine proteins and the suppression of apoptosis in polyglutamine diseases, a role in the dislocation of newly synthesized MHC class I heavy chains from the endoplasmic reticulum, and involvement in foam cell formation.

Molecular Weight: 22 kDa (MW of target protein)