UBE2K antibody (N-Term)
-
- Target See all UBE2K Antibodies
- UBE2K (Ubiquitin-Conjugating Enzyme E2K (UBE2K))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat, Dog, Zebrafish (Danio rerio)
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This UBE2K antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- HIP2 antibody was raised against the N terminal of HIP2
- Purification
- Purified
- Immunogen
- HIP2 antibody was raised using the N terminal of HIP2 corresponding to a region with amino acids MANIAVQRIKREFKEVLKSEETSKNQIKVDLVDENFTELRGEIAGPPDTP
- Top Product
- Discover our top product UBE2K Primary Antibody
-
-
- Application Notes
-
WB: 5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
HIP2 Blocking Peptide, catalog no. 33R-5707, is also available for use as a blocking control in assays to test for specificity of this HIP2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HIP2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- UBE2K (Ubiquitin-Conjugating Enzyme E2K (UBE2K))
- Alternative Name
- HIP2 (UBE2K Products)
- Synonyms
- E2-25K antibody, HIP2 antibody, HYPG antibody, LIG antibody, UBC1 antibody, E2-25k antibody, Hip2 antibody, Hypg antibody, Lig antibody, e2-25k antibody, hip2 antibody, hypg antibody, lig antibody, AW492011 antibody, D5Ertd601e antibody, ube2k antibody, zgc:103472 antibody, zgc:110791 antibody, ubiquitin conjugating enzyme E2 K antibody, ubiquitin-conjugating enzyme E2K antibody, ubiquitin conjugating enzyme E2 K S homeolog antibody, ubiquitin-conjugating enzyme E2Kb (UBC1 homolog, yeast) antibody, ubiquitin-conjugating enzyme E2Ka (UBC1 homolog, yeast) antibody, UBE2K antibody, Ube2k antibody, ube2k.S antibody, ube2k antibody, ube2kb antibody, ube2ka antibody
- Background
- HIP2 belongs to the ubiquitin-conjugating enzyme family. It binds selectively to a large region at the N terminus of huntingtin. This interaction is not influenced by the length of the huntingtin polyglutamine tract. This protein has been implicated in the degradation of huntingtin and suppression of apoptosis.
- Molecular Weight
- 22 kDa (MW of target protein)
-