CGR19 antibody (Middle Region)
-
- Target See all CGR19 (CGRRF1) Antibodies
- CGR19 (CGRRF1) (Cell Growth Regulator with Ring Finger Domain 1 (CGRRF1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CGR19 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- CGRRF1 antibody was raised against the middle region of CGRRF1
- Purification
- Affinity purified
- Immunogen
- CGRRF1 antibody was raised using the middle region of CGRRF1 corresponding to a region with amino acids KKDSKEEIYCQLPRDTKIEDFGTVPRSRYPLVALLTLADEDDREIYDIIS
- Top Product
- Discover our top product CGRRF1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CGRRF1 Blocking Peptide, catalog no. 33R-4453, is also available for use as a blocking control in assays to test for specificity of this CGRRF1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CGRRF1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CGR19 (CGRRF1) (Cell Growth Regulator with Ring Finger Domain 1 (CGRRF1))
- Alternative Name
- CGRRF1 (CGRRF1 Products)
- Synonyms
- MGC85426 antibody, CGRRF1 antibody, si:dkey-29m11.5 antibody, si:dkey-63j12.2 antibody, zgc:136229 antibody, CGR19 antibody, RNF197 antibody, 1110038G02Rik antibody, 1810009H17Rik antibody, Cgr19 antibody, cell growth regulator with ring finger domain 1 L homeolog antibody, cell growth regulator with ring finger domain 1 antibody, cgrrf1.L antibody, CGRRF1 antibody, cgrrf1 antibody, Cgrrf1 antibody
- Background
- CGRRF1 is able to inhibit growth in several cell lines.
- Molecular Weight
- 38 kDa (MW of target protein)
-