HACE1 antibody (Middle Region)

Catalog No. ABIN631377

The Rabbit Polyclonal anti-HACE1 antibody (ABIN631377) specifically detects HACE1 in WB. The antibody is reactive with Human, Mouse and Rat samples.

Quick Overview for HACE1 antibody (Middle Region) (ABIN631377)

Target: HACE1 (HECT Domain and Ankyrin Repeat Containing, E3 Ubiquitin Protein Ligase 1 (HACE1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HACE1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-HACE1 Antibody

Binding Specificity: Middle Region

Specificity: HACE1 antibody was raised against the middle region of HACE1

Purification: Affinity purified

Immunogen: HACE1 antibody was raised using the middle region of HACE1 corresponding to a region with amino acids DVSDWIKNTEYTSGYEREDPVIQWFWEVVEDITQEERVLLLQFVTGSSRV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HACE1 Blocking Peptide, (ABIN937609), is also available for use as a blocking control in assays to test for specificity of this HACE1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HACE1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for HACE1

Target: HACE1 (HECT Domain and Ankyrin Repeat Containing, E3 Ubiquitin Protein Ligase 1 (HACE1))

Alternative Name: HACE1

Background: HACE1 contains 6 ANK repeats and 1 HECT (E6AP-type E3 ubiquitin-protein ligase) domain. HACE1 is an E3 ubiquitin-protein ligase that may function in cellular proteins degradation.

Molecular Weight: 102 kDa (MW of target protein)