VPS37A antibody

Catalog No. ABIN631404

Product Details anti-VPS37A Antibody

Target: VPS37A (Vacuolar Protein Sorting 37 Homolog A (VPS37A))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This VPS37A antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: VPS37 A antibody was raised using a synthetic peptide corresponding to a region with amino acids SWLFPLTKSASSSAAGSPGGLTSLQQQKQRLIESLRNSHSSIAEIQKDVE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

VPS37A Blocking Peptide, catalog no. 33R-8941, is also available for use as a blocking control in assays to test for specificity of this VPS37A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VPS30 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for VPS37A

Target: VPS37A (Vacuolar Protein Sorting 37 Homolog A (VPS37A))

Alternative Name: VPS37A (VPS37A Products)

Synonyms: fb08f03 antibody, fj42c03 antibody, zgc:73244 antibody, zgc:77637 antibody, wu:fb08f03 antibody, wu:fj42c03 antibody, HCRP1 antibody, PQBP2 antibody, SPG53 antibody, 2210018P21Rik antibody, 4930592A21Rik antibody, AW261445 antibody, D8Ertd531e antibody, vacuolar protein sorting 37A antibody, VPS37A, ESCRT-I subunit antibody, vacuolar protein sorting 37 homolog A antibody, vacuolar protein sorting 37 homolog A L homeolog antibody, vps37a antibody, VPS37A antibody, vps37a.L antibody, Vps37a antibody

Background: VPS37A is a component of the ESCRT-I complex, a regulator of vesicular trafficking process. Required for the sorting of endocytic ubiquitinated cargos into multivesicular bodies. VPS37A may be involved in cell growth and differentiation.

Molecular Weight: 44 kDa (MW of target protein)