MYO1E antibody (Middle Region)

Catalog No. ABIN631474

Product Details anti-MYO1E Antibody

Target: MYO1E (Myosin IE (MYO1E))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MYO1E antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Myosin Ie antibody was raised against the middle region of MYO1 E

Purification: Affinity purified

Immunogen: Myosin Ie antibody was raised using the middle region of MYO1 E corresponding to a region with amino acids PKPQPKPKPQVPQCKALYAYDAQDTDELSFNANDIIDIIKEDPSGWWTGR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Myosin Ie Blocking Peptide, catalog no. 33R-7176, is also available for use as a blocking control in assays to test for specificity of this Myosin Ie antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MYO0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MYO1E

Target: MYO1E (Myosin IE (MYO1E))

Alternative Name: Myosin Ie (MYO1E Products)

Synonyms: FSGS6 antibody, HuncM-IC antibody, MYO1C antibody, MYR5 antibody, Myr3 antibody, 2310020N23Rik antibody, 9130023P14Rik antibody, AA407778 antibody, myosin-1e antibody, myr 3 antibody, myo1e antibody, wu:fc15g04 antibody, wu:fe49h01 antibody, myosin IE antibody, myosin IE, a antibody, MYO1E antibody, Myo1e antibody, myo1ea antibody

Background: Myosins are actin-based motor molecules with ATPase activity. Unconventional myosins serve in intracellular movements. Their highly divergent tails are presumed to bind to membranous compartments, which would be moved relative to actin filaments.

Molecular Weight: 127 kDa (MW of target protein)

Pathways: Platelet-derived growth Factor Receptor Signaling