Add to Basket
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Cytokeratin 7 (KRT7) antibody

Antigen

Cytokeratin 7 (KRT7)

Synonyms KRT7, CK7, K7, Krt2-7, MGC11625, D15Wsu77e, SCL, K2C7, MGC3625, MGC129731
Clonality Polyclonal
Host
Alternatives

Rabbit

Application
Alternatives Western Blotting (WB)
Catalog no. ABIN631503
Quantity 50 ug  (1 mg/ml)  (Variants)
Price 478.33 $   Plus shipping costs $35.00
Shipping to
Availability Ships within 5 to 7 Business Days

Additional Information

Alternative name Cytokeratin 7
Immunogen Cytokeratin 7 antibody was raised using the N terminal of KRT7 corresponding to a region with amino acids SIHFSSPVFTSRSAAFSGRGAQVRLSSARPGGLGSSSLYGLGASRPRVAV
Description KRT7 is a member of the keratin protein family. The type II cytokeratins consist of basic or neutral proteins which are arranged in pairs of heterotypic keratin chains coexpressed during differentiation of simple and stratified epithelial tissues. This type II cytokeratin is specifically expressed in the simple epithelia lining the cavities of the internal organs and in the gland ducts and blood vessels. The genes encoding the type II cytokeratins are clustered in a region of chromosome 12q12-q13.
Molecular Weight 52 kDa (MW of target protein)

Application Details

Concentration 1 mg/ml
Purification Affinity purified
Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KRT7 antibody in PBS
Storage Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.
Research Area Signaling, Cytoskeleton, Cytokeratins, Extracellular Matrix
Restrictions For Research Use only

Alternatives

Alternatives for antigen "Cytokeratin 7 (KRT7)", type "Antibodies"
Hosts Mouse (29), Rabbit (19), Guinea Pig (1)
Reactivities Human (43), Rat (Rattus) (5), Dog (Canine) (3), Hamster (3), Mouse (Murine) (3), Pig (Porcine) (3), Cat (Feline) (2), Cow (Bovine) (1), Sheep (Ovine) (1)
Applications Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (35), Western Blotting (WB) (26), Immunohistochemistry (Frozen Sections) (IHC (fro)) (21), Immunofluorescence (IF) (11), Flow Cytometry (FACS) (6), Immunohistochemistry (IHC) (5), ELISA (Detection) (3), Enzyme Immunoassay (EIA) (2), Immunoprecipitation (IP) (1)
Conjugates FITC (2)
Epitopes C-Term (2), N-Term (1)