CHST14 antibody

Catalog No. ABIN631540

This Rabbit Polyclonal antibody specifically detects CHST14 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for CHST14 antibody (ABIN631540)

Target: CHST14 (Carbohydrate (N-Acetylgalactosamine 4-0) Sulfotransferase 14 (CHST14))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CHST14 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-CHST14 Antibody

Purification: Affinity purified

Immunogen: CHST14 antibody was raised using a synthetic peptide corresponding to a region with amino acids REYQQRYGAEIVRRYRAGAGPSPAGDDVTFPEFLRYLVDEDPERMNEHWM

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CHST14 Blocking Peptide, (ABIN5612876), is also available for use as a blocking control in assays to test for specificity of this CHST14 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHST14 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CHST14

Target: CHST14 (Carbohydrate (N-Acetylgalactosamine 4-0) Sulfotransferase 14 (CHST14))

Alternative Name: CHST14

Background: CHST14 belongs to the sulfotransferase 2 family. CHST14 catalyzes the transfer of sulfate to position 4 of the N-acetylgalactosamine (GalNAc) residue of dermatan sulfate. It transfers sulfate to the C-4 hydroxyl of beta1,4-linked GalNAc that is substituted with an alpha-linked iduronic acid (IdoUA) at the C-3 hydroxyl. It transfers sulfate more efficiently to GalNAc residues in -IdoUA-GalNAc-IdoUA- than in -GlcUA-GalNAc-GlcUA-sequences. CHST14 has preference for partially desulfated dermatan sulfate. Addition of sulfate to GalNAc may occur immediately after epimerization of GlcUA to IdoUA.

Molecular Weight: 35 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process