METTL7B antibody (Middle Region)

Catalog No. ABIN631547

The Rabbit Polyclonal anti-METTL7B antibody is suitable to detect METTL7B in samples from Human. It has been validated for WB.

Quick Overview for METTL7B antibody (Middle Region) (ABIN631547)

Target: METTL7B (Methyltransferase Like 7B (METTL7B))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This METTL7B antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-METTL7B Antibody

Binding Specificity: Middle Region

Specificity: METTL7 B antibody was raised against the middle region of METTL7

Purification: Affinity purified

Immunogen: METTL7 B antibody was raised using the middle region of METTL7 corresponding to a region with amino acids FVVAPGEDMRQLADGSMDVVVCTLVLCSVQSPRKVLQEVRRVLRPGGVLF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

METTL7B Blocking Peptide, (ABIN938509), is also available for use as a blocking control in assays to test for specificity of this METTL7B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of METTL0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for METTL7B

Target: METTL7B (Methyltransferase Like 7B (METTL7B))

Alternative Name: METTL7B

Background: METTL7B belongs to the methyltransferase superfamily. It is a probable methyltransferase.

Molecular Weight: 22 kDa (MW of target protein)