RPS15 antibody (Middle Region)

Catalog No. ABIN631579

Product Details anti-RPS15 Antibody

Target: RPS15 (Ribosomal Protein S15 (RPS15))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat, C. elegans

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RPS15 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RPS15 antibody was raised against the middle region of RPS15

Purification: Affinity purified

Immunogen: RPS15 antibody was raised using the middle region of RPS15 corresponding to a region with amino acids GVYNGKTFNQVEIKPEMIGHYLGEFSITYKPVKHGRPGIGATHSSRFIPL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RPS15 Blocking Peptide, catalog no. 33R-3662, is also available for use as a blocking control in assays to test for specificity of this RPS15 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPS15 antibody in PBS

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RPS15

Target: RPS15 (Ribosomal Protein S15 (RPS15))

Alternative Name: RPS15 (RPS15 Products)

Synonyms: RIG antibody, S15 antibody, rig antibody, wu:fa93f04 antibody, wu:fa99b07 antibody, zgc:103714 antibody, zgc:92743 antibody, ribosomal protein S15 antibody, 40S ribosomal protein S15 antibody, RPS15 antibody, Rps15 antibody, rps15 antibody, rps-15 antibody

Background: Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins.

Molecular Weight: 17 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization, Ribosome Assembly