NR4A3 antibody (Middle Region)

Catalog No. ABIN631676

The Rabbit Polyclonal anti-NR4A3 antibody is suitable to detect NR4A3 in samples from Human, Mouse and Rat. It has been validated for WB.

Quick Overview for NR4A3 antibody (Middle Region) (ABIN631676)

Target: NR4A3 (Nuclear Receptor Subfamily 4, Group A, Member 3 (NR4A3))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NR4A3 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-NR4A3 Antibody

Binding Specificity: Middle Region

Specificity: NR4 A3 antibody was raised against the middle region of NR4 3

Purification: Affinity purified

Immunogen: NR4 A3 antibody was raised using the middle region of NR4 3 corresponding to a region with amino acids KCLSVGMVKEVVRTDSLKGRRGRLPSKPKSPLQQEPSQPSPPSPPICMMN

Application Details

Application Notes: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NR4A3 Blocking Peptide, (ABIN939658), is also available for use as a blocking control in assays to test for specificity of this NR4A3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NR0 3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NR4A3

Target: NR4A3 (Nuclear Receptor Subfamily 4, Group A, Member 3 (NR4A3))

Alternative Name: NR4A3

Background: NR4A3 is a member of the steroid-thyroid hormone-retinoid receptor superfamily. NR4A3 may act as a transcriptional activator. The protein can efficiently bind the NGFI-B Response Element (NBRE). Three different versions of extraskeletal myxoid chondrosarcomas (EMCs) are the result of reciprocal translocations between NR4A3 gene and other genes.

Molecular Weight: 64 kDa (MW of target protein)

Pathways: Fc-epsilon Receptor Signaling Pathway, Nuclear Receptor Transcription Pathway, Steroid Hormone Mediated Signaling Pathway