BPNT1 antibody
-
- Target See all BPNT1 Antibodies
- BPNT1 (3'(2'), 5'-Bisphosphate Nucleotidase 1 (BPNT1))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This BPNT1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- BPNT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids DRVTIQELTAPLLTTAQAKPGETQEEETNSGEEPFIETPRQDGVSRRFIP
- Top Product
- Discover our top product BPNT1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
BPNT1 Blocking Peptide, catalog no. 33R-2153, is also available for use as a blocking control in assays to test for specificity of this BPNT1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BPNT1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- BPNT1 (3'(2'), 5'-Bisphosphate Nucleotidase 1 (BPNT1))
- Alternative Name
- BPNT1 (BPNT1 Products)
- Synonyms
- BPNT1 antibody, PIP antibody, Sal3 antibody, BPntase antibody, 3'(2'), 5'-bisphosphate nucleotidase 1 antibody, bisphosphate 3'-nucleotidase 1 antibody, BPNT1 antibody, bpnt1.L antibody, Bpnt1 antibody
- Background
- BPNT1, also called bisphosphate 3-prime-nucleotidase, or BPntase, is a member of a magnesium-dependent phosphomonoesterase family. Lithium, a major drug used to treat manic depression, acts as an uncompetitive inhibitor of BPntase. The predicted human protein is 92% identical to mouse BPntase. BPntase's physiologic role in nucleotide metabolism may be regulated by inositol signaling pathways. The inhibition of human BPntase may account for lithium-induced nephrotoxicity.
- Molecular Weight
- 29 kDa (MW of target protein)
- Pathways
- Inositol Metabolic Process
-