HIPK4 antibody (Middle Region)

Catalog No. ABIN631807

Product Details anti-HIPK4 Antibody

Target: HIPK4 (Homeodomain Interacting Protein Kinase 4 (HIPK4))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HIPK4 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: HIPK4 antibody was raised against the middle region of HIPK4

Purification: Affinity purified

Immunogen: HIPK4 antibody was raised using the middle region of HIPK4 corresponding to a region with amino acids AEEKEAAGMGSVAGSSPFFREEKAPGMQRAIDQLDDLSLQEAGHGLWGET

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HIPK4 Blocking Peptide, catalog no. 33R-1123, is also available for use as a blocking control in assays to test for specificity of this HIPK4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HIPK4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for HIPK4

Target: HIPK4 (Homeodomain Interacting Protein Kinase 4 (HIPK4))

Alternative Name: HIPK4 (HIPK4 Products)

Synonyms: Gm162 antibody, homeodomain interacting protein kinase 4 antibody, HIPK4 antibody, Hipk4 antibody

Background: HIPK4 is a protein kinase that phosphorylates human TP53 at Ser-9, and thus induces TP53 repression of BIRC5 promoter. It may act as a corepressor of transcription factors.

Molecular Weight: 69 kDa (MW of target protein)