CYB5D1 antibody (Middle Region)
-
- Target See all CYB5D1 Antibodies
- CYB5D1 (Cytochrome B5 Domain Containing 1 (CYB5D1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CYB5D1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- CYB5 D1 antibody was raised against the middle region of CYB5 1
- Purification
- Affinity purified
- Immunogen
- CYB5 D1 antibody was raised using the middle region of CYB5 1 corresponding to a region with amino acids KYEGKNLNMDFTLEENGIRDEEEEFDYLSMDGTLHTPAILLYFNDDLTEL
- Top Product
- Discover our top product CYB5D1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CYB5D1 Blocking Peptide, catalog no. 33R-4736, is also available for use as a blocking control in assays to test for specificity of this CYB5D1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYB0 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CYB5D1 (Cytochrome B5 Domain Containing 1 (CYB5D1))
- Alternative Name
- CYB5D1 (CYB5D1 Products)
- Synonyms
- RGD1559567 antibody, MGC146746 antibody, DKFZp459B103 antibody, Gm740 antibody, zgc:112008 antibody, cytochrome b5 domain containing 1 antibody, cytochrome b5 domain containing 1 L homeolog antibody, Cyb5d1 antibody, cyb5d1.L antibody, CYB5D1 antibody, cyb5d1 antibody
- Background
- The function of CYB protein is not widely studied, and is yet to be elucidated fully.
- Molecular Weight
- 27 kDa (MW of target protein)
-