CYB5D1 antibody (Middle Region)

Catalog No. ABIN631853

Product Details anti-CYB5D1 Antibody

Target: CYB5D1 (Cytochrome B5 Domain Containing 1 (CYB5D1))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CYB5D1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CYB5 D1 antibody was raised against the middle region of CYB5 1

Purification: Affinity purified

Immunogen: CYB5 D1 antibody was raised using the middle region of CYB5 1 corresponding to a region with amino acids KYEGKNLNMDFTLEENGIRDEEEEFDYLSMDGTLHTPAILLYFNDDLTEL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CYB5D1 Blocking Peptide, catalog no. 33R-4736, is also available for use as a blocking control in assays to test for specificity of this CYB5D1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYB0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CYB5D1

Target: CYB5D1 (Cytochrome B5 Domain Containing 1 (CYB5D1))

Alternative Name: CYB5D1 (CYB5D1 Products)

Synonyms: RGD1559567 antibody, MGC146746 antibody, DKFZp459B103 antibody, Gm740 antibody, zgc:112008 antibody, cytochrome b5 domain containing 1 antibody, cytochrome b5 domain containing 1 L homeolog antibody, Cyb5d1 antibody, cyb5d1.L antibody, CYB5D1 antibody, cyb5d1 antibody

Background: The function of CYB protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 27 kDa (MW of target protein)