NUDCD3 antibody (Middle Region)

Catalog No. ABIN631858

Product Details anti-NUDCD3 Antibody

Target: NUDCD3 (NudC Domain Containing 3 (NUDCD3))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NUDCD3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: NUDCD3 antibody was raised against the middle region of NUDCD3

Purification: Affinity purified

Immunogen: NUDCD3 antibody was raised using the middle region of NUDCD3 corresponding to a region with amino acids KINKERSMATVDEEEQAVLDRLTFDYHQKLQGKPQSHELKVHEMLKKGWD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NUDCD3 Blocking Peptide, catalog no. 33R-4441, is also available for use as a blocking control in assays to test for specificity of this NUDCD3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NUDCD3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NUDCD3

Target: NUDCD3 (NudC Domain Containing 3 (NUDCD3))

Alternative Name: NUDCD3 (NUDCD3 Products)

Synonyms: NudCL antibody, AI427847 antibody, BC024322 antibody, RP23-28G13.2 antibody, mKIAA1068 antibody, NudC domain containing 3 antibody, Nudcd3 antibody, NUDCD3 antibody

Background: The product of this gene functions to maintain the stability of dynein intermediate chain. Depletion of this gene product results in aggregation and degradation of dynein intermediate chain and mislocalization of the dynein complex from kinetochores.

Molecular Weight: 41 kDa (MW of target protein)