Pellino 3 antibody

Catalog No. ABIN631913

The Rabbit Polyclonal anti-Pellino 3 antibody is suitable to detect Pellino 3 in samples from Human. It has been validated for WB.

Quick Overview for Pellino 3 antibody (ABIN631913)

Target: Pellino 3 (PELI3) (Pellino E3 Ubiquitin Protein Ligase Family Member 3 (PELI3))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Pellino 3 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Pellino 3 Antibody

Purification: Affinity purified

Immunogen: PELI3 antibody was raised using a synthetic peptide corresponding to a region with amino acids VLEGNPEVGSPRTSDLQHRGNKGSCVLSSPGEDAQPGEEPIKYGELIVLG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PELI3 Blocking Peptide, (ABIN5615306), is also available for use as a blocking control in assays to test for specificity of this PELI3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PELI3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Pellino 3

Target: Pellino 3 (PELI3) (Pellino E3 Ubiquitin Protein Ligase Family Member 3 (PELI3))

Alternative Name: PELI3

Background: Toll-like receptors (TLRs) and IL1R (IL1R1) are part of the innate immune response aimed at mobilizing defense mechanisms in response in infection or injury. Pellino proteins, such as PELI3, are intermediate components in the signaling cascades initiated by TLRs and IL1R.

Molecular Weight: 48 kDa (MW of target protein)

Pathways: Toll-Like Receptors Cascades