ENOSF1 antibody (N-Term)

Catalog No. ABIN631927

Product Details anti-ENOSF1 Antibody

Target: ENOSF1 (Enolase Superfamily Member 1 (ENOSF1))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ENOSF1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ENOSF1 antibody was raised against the N terminal of ENOSF1

Purification: Affinity purified

Immunogen: ENOSF1 antibody was raised using the N terminal of ENOSF1 corresponding to a region with amino acids MVRGRISRLSVRDVRFPTSLGGHGADAMHTDPDYSAAYVVIETDAEDGIK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ENOSF1 Blocking Peptide, catalog no. 33R-6601, is also available for use as a blocking control in assays to test for specificity of this ENOSF1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ENOSF1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ENOSF1

Target: ENOSF1 (Enolase Superfamily Member 1 (ENOSF1))

Alternative Name: ENOSF1 (ENOSF1 Products)

Synonyms: HSRTSBETA antibody, RTS antibody, TYMSAS antibody, enolase superfamily member 1 antibody, enolase superfamily member 1 S homeolog antibody, ENOSF1 antibody, enosf1.S antibody

Background: This gene was originally identified as a naturally occurring antisense transcript to the human thymidylate synthase gene. Alternate splice variants have been described.

Molecular Weight: 50 kDa (MW of target protein)