VPS26B antibody

Catalog No. ABIN632013

The Rabbit Polyclonal anti-VPS26B antibody (ABIN632013) specifically detects VPS26B in WB. The antibody is reactive with Human, Mouse and Rat samples.

Quick Overview for VPS26B antibody (ABIN632013)

Target: VPS26B (Vacuolar Protein Sorting 26 Homolog B (VPS26B))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This VPS26B antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-VPS26B Antibody

Purification: Affinity purified

Immunogen: VPS26 B antibody was raised using a synthetic peptide corresponding to a region with amino acids AGYELTPTMRDINKKFSVRYYLNLVLIDEEERRYFKQQEVVLWRKGDIVR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

VPS26B Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this VPS26B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VPS20 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for VPS26B

Target: VPS26B (Vacuolar Protein Sorting 26 Homolog B (VPS26B))

Alternative Name: VPS26B

Background: VPS26B belongs to the VPS26 family. VPS26B is probable component of the retromer complex, a complex required to retrieve lysosomal enzyme receptors (IGF2R and M6PR) from endosomes to the trans-Golgi network.

Molecular Weight: 39 kDa (MW of target protein)

Pathways: Cellular Glucan Metabolic Process