NDUFS1 antibody (Middle Region)

Catalog No. ABIN632032

This Rabbit Polyclonal antibody specifically detects NDUFS1 in WB. It exhibits reactivity toward Human.

Quick Overview for NDUFS1 antibody (Middle Region) (ABIN632032)

Target: NDUFS1 (NADH Dehydrogenase (Ubiquinone) Fe-S Protein 1, 75kDa (NADH-Coenzyme Q Reductase) (NDUFS1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NDUFS1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-NDUFS1 Antibody

Binding Specificity: Middle Region

Specificity: NDUFS1 antibody was raised against the middle region of NDUFS1

Purification: Affinity purified

Immunogen: NDUFS1 antibody was raised using the middle region of NDUFS1 corresponding to a region with amino acids TPPGLAREDWKIIRALSEIAGMTLPYDTLDQVRNRLEEVSPNLVRYDDIE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NDUFS1 Blocking Peptide, (ABIN5614944), is also available for use as a blocking control in assays to test for specificity of this NDUFS1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NDUFS1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NDUFS1

Target: NDUFS1 (NADH Dehydrogenase (Ubiquinone) Fe-S Protein 1, 75kDa (NADH-Coenzyme Q Reductase) (NDUFS1))

Alternative Name: NDUFS1

Background: The protein encoded by this gene belongs to the complex I 75 kDa subunit family. Mammalian complex I is composed of 45 different subunits. It locates at the mitochondrial inner membrane. This protein has NADH dehydrogenase activity and oxidoreductase activity. It transfers electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. This protein is the largest subunit of complex I and it is a component of the iron-sulfur (IP) fragment of the enzyme. It may form part of the active site crevice where NADH is oxidized. Mutations in this gene are associated with complex I deficiency.

Molecular Weight: 77 kDa (MW of target protein)