PPM1M antibody (Middle Region)

Catalog No. ABIN632161

Product Details anti-PPM1M Antibody

Target: PPM1M (Protein Phosphatase 1M (PP2C Domain Containing) (PPM1M))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PPM1M antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PPM1 M antibody was raised against the middle region of PPM1

Purification: Affinity purified

Immunogen: PPM1 M antibody was raised using the middle region of PPM1 corresponding to a region with amino acids VYPELLAGEFTRLEFPRRLKGDDLGQKVLFRDHHMSGWSYKRVEKSDLKY

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PPM1M Blocking Peptide, catalog no. 33R-9923, is also available for use as a blocking control in assays to test for specificity of this PPM1M antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPM0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PPM1M

Target: PPM1M (Protein Phosphatase 1M (PP2C Domain Containing) (PPM1M))

Alternative Name: PPM1M (PPM1M Products)

Synonyms: 2810423O19Rik antibody, AW610647 antibody, C77250 antibody, PP2Ceta antibody, PP2C-eta antibody, PP2CE antibody, protein phosphatase 1M antibody, protein phosphatase, Mg2+/Mn2+ dependent 1M antibody, Ppm1m antibody, PPM1M antibody

Background: PPM1M belongs to the PP2C family. It contains 1 PP2C-like domain. The exact function of PPM1M is not known.

Molecular Weight: 30 kDa (MW of target protein)