PPM1M antibody (Middle Region)
-
- Target See all PPM1M products
- PPM1M (Protein Phosphatase 1M (PP2C Domain Containing) (PPM1M))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PPM1M antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PPM1 M antibody was raised against the middle region of PPM1
- Purification
- Affinity purified
- Immunogen
- PPM1 M antibody was raised using the middle region of PPM1 corresponding to a region with amino acids VYPELLAGEFTRLEFPRRLKGDDLGQKVLFRDHHMSGWSYKRVEKSDLKY
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PPM1M Blocking Peptide, catalog no. 33R-9923, is also available for use as a blocking control in assays to test for specificity of this PPM1M antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPM0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PPM1M (Protein Phosphatase 1M (PP2C Domain Containing) (PPM1M))
- Alternative Name
- PPM1M (PPM1M Products)
- Synonyms
- 2810423O19Rik antibody, AW610647 antibody, C77250 antibody, PP2Ceta antibody, PP2C-eta antibody, PP2CE antibody, protein phosphatase 1M antibody, protein phosphatase, Mg2+/Mn2+ dependent 1M antibody, Ppm1m antibody, PPM1M antibody
- Background
- PPM1M belongs to the PP2C family. It contains 1 PP2C-like domain. The exact function of PPM1M is not known.
- Molecular Weight
- 30 kDa (MW of target protein)
-