GFPT2 antibody (Middle Region)

Catalog No. ABIN632223

Product Details anti-GFPT2 Antibody

Target: GFPT2 (Glutamine-Fructose-6-Phosphate Transaminase 2 (GFPT2))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GFPT2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: GFPT2 antibody was raised against the middle region of GFPT2

Purification: Affinity purified

Immunogen: GFPT2 antibody was raised using the middle region of GFPT2 corresponding to a region with amino acids TARQGRPIILCSKDDTESSKFAYKTIELPHTVDCLQGILSVIPLQLLSFH

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GFPT2 Blocking Peptide, catalog no. 33R-8983, is also available for use as a blocking control in assays to test for specificity of this GFPT2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GFPT2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GFPT2

Target: GFPT2 (Glutamine-Fructose-6-Phosphate Transaminase 2 (GFPT2))

Alternative Name: GFPT2 (GFPT2 Products)

Synonyms: gfpt1 antibody, AI480523 antibody, GFAT2 antibody, glutamine-fructose-6-phosphate transaminase 2 L homeolog antibody, glutamine-fructose-6-phosphate transaminase 2 antibody, glutamine fructose-6-phosphate transaminase 2 antibody, gfpt2.L antibody, GFPT2 antibody, gfpt2 antibody, Gfpt2 antibody

Background: GFPT2 controls the flux of glucose into the hexosamine pathway. GFPT2 is most likely involved in regulating the availability of precursors for N- and O-linked glycosylation of proteins.

Molecular Weight: 77 kDa (MW of target protein)